PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0382s0350.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 696aa    MW: 76668.2 Da    PI: 5.8598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0382s0350.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.96.8e-963406945374
                    GRAS   5 LlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                             + ++Ae +++g+   aq +Larl+++ + p g+p qR a+yf+ AL+  l++      +  +   ++  n + ++ a+k fse+sPi
  SapurV1A.0382s0350.4.p 340 ICQAAELIETGNPVHAQGILARLNHQlSLPIGKPYQRTAFYFKDALQLLLHS------SNNSNLMDTACNLIFKIGAYKSFSEISPI 420
                             689*********************99788999*******************9......3333334444679**************** PP

                    GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                             l+f+++t+Nq +lea+eg+er+Hi+Dfdi++G+QW++L+q+La +++g+psl+iT+++sp+s+++ el  t+e+L+ fA+e+++pfe
  SapurV1A.0382s0350.4.p 421 LQFANFTCNQVLLEAFEGSERIHIVDFDIGYGGQWASLMQELALKAGGAPSLKITAFASPSSHDELELGFTQENLRIFASEMNMPFE 507
                             *************************************************************************************** PP

                    GRAS 178 fnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                              ++l  ++l +   + L   ++++E++aVnl +   ++ +++ +l+     vL++vk+lsPkvvv  ++ +d+++ +F++++ +a++
  SapurV1A.0382s0350.4.p 508 LEILSLESLGSG-SWPLppCTSEKEVTAVNLPIG--SFSNDPSTLPV----VLRFVKQLSPKVVVSLDRGCDRSDLPFAHHVNHAIQ 587
                             ***955555554.5666434555*********95..55556666666....************************************ PP

                    GRAS 263 yysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                              ys+l++sl ++++  + ++ +k+Er+l+++ i+++v  +++      e+   Wr  + ++GF p+++s+++++qa++l+++++++g
  SapurV1A.0382s0350.4.p 588 SYSTLLESLdAVNV--HPDALQKIERFLVQPGIEKLVLGRHRC----PERTPPWRTLFLQSGFIPLTFSNFTESQAEYLVQRTPVRG 668
                             *********55554..5578899***************99998....9999************************************ PP

                    GRAS 349 yrveeesgslvlgWkdrpLvsvSaWr 374
                             ++ve+++ slvl+W++  Lvs+SaWr
  SapurV1A.0382s0350.4.p 669 FHVEKRQSSLVLCWQRMDLVSASAWR 694
                             *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.168310674IPR005202Transcription factor GRAS
PfamPF035142.4E-93340694IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MKAMPLPSED FQGKGVFDFS SSTTSSPDSL HQYHRRWQNN NSKESCGFFV GGAEPTSVLD  60
TISRQSPPTS SSTLSSSQGG GGGGGASTDT TNDAAAAGGS IPCLDEKCGQ QLGMEDWESV  120
LPGSPSQEQS ILRLIMGDIE DPSAGLNKLL QSGSRSLEME HASGFGVVDQ VFGFDISQMS  180
SASANLVANN NSIDPSSIHG LFQQQQQQTA FNQDEKPQIL NPGMISNQNQ HQFVQNPAML  240
LPFSYSQLQE HHNSQHFSSP PPSKRLNSGP VGVNYVPKVF DSRPPELFLP RQHQQQQQNH  300
QFQMLQQQQQ QKQGMIMNQK MATDELVNQQ QLQQATINPI CQAAELIETG NPVHAQGILA  360
RLNHQLSLPI GKPYQRTAFY FKDALQLLLH SSNNSNLMDT ACNLIFKIGA YKSFSEISPI  420
LQFANFTCNQ VLLEAFEGSE RIHIVDFDIG YGGQWASLMQ ELALKAGGAP SLKITAFASP  480
SSHDELELGF TQENLRIFAS EMNMPFELEI LSLESLGSGS WPLPPCTSEK EVTAVNLPIG  540
SFSNDPSTLP VVLRFVKQLS PKVVVSLDRG CDRSDLPFAH HVNHAIQSYS TLLESLDAVN  600
VHPDALQKIE RFLVQPGIEK LVLGRHRCPE RTPPWRTLFL QSGFIPLTFS NFTESQAEYL  660
VQRTPVRGFH VEKRQSSLVL CWQRMDLVSA SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2937169437375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2118040.0AC211804.1 Populus trichocarpa clone POP017-B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033505.10.0PREDICTED: scarecrow-like protein 22 isoform X2
SwissprotO813161e-149SCL6_ARATH; Scarecrow-like protein 6
TrEMBLU5FPJ80.0U5FPJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-138GRAS family protein